Lineage for d5yawb_ (5yaw B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2361840Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2362347Family b.1.18.8: RhoGDI-like [81288] (3 proteins)
  6. 2362348Protein GMP-PDE delta [74846] (1 species)
  7. 2362349Species Human (Homo sapiens) [TaxId:9606] [74847] (25 PDB entries)
  8. 3057169Domain d5yawb_: 5yaw B: [357231]
    automated match to d5x72a_
    complexed with 8sl

Details for d5yawb_

PDB Entry: 5yaw (more details), 2.03 Å

PDB Description: fragment-based drug discovery of inhibitors to block pdedelta-ras protein-protein interaction
PDB Compounds: (B:) Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta

SCOPe Domain Sequences for d5yawb_:

Sequence, based on SEQRES records: (download)

>d5yawb_ b.1.18.8 (B:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]}
sakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsr
elnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmmpas
vltgnviietkffdddllvstsrvrlfyv

Sequence, based on observed residues (ATOM records): (download)

>d5yawb_ b.1.18.8 (B:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]}
sakderareilrgfklnwmnlrdatgkilwqgtedlsvpgvehearvpkkilkckavsre
lnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaasqmmpasvlt
gnviietkffdddllvstsrvrlfyv

SCOPe Domain Coordinates for d5yawb_:

Click to download the PDB-style file with coordinates for d5yawb_.
(The format of our PDB-style files is described here.)

Timeline for d5yawb_:

  • d5yawb_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-06