Lineage for d5yiga_ (5yig A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537076Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2537077Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2537694Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2537695Protein automated matches [226867] (15 species)
    not a true protein
  7. 3057045Species Streptococcus pneumoniae [TaxId:760839] [357107] (1 PDB entry)
  8. 3057164Domain d5yiga_: 5yig A: [357226]
    automated match to d5boda_
    complexed with 54b

Details for d5yiga_

PDB Entry: 5yig (more details), 2.8 Å

PDB Description: crystal structure of streptococcus pneumonia pare with inhibitor
PDB Compounds: (A:) DNA topoisomerase 4 subunit B

SCOPe Domain Sequences for d5yiga_:

Sequence, based on SEQRES records: (download)

>d5yiga_ d.122.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 760839]}
vlegldavrkrpgmyigstdgaglhhlvweivdnavdealsgfgdridvtinkdgsltvq
dhgrgmptgmhamgiptveviftilhaggkfgqggyktsgglhgvgssvvnalsswleve
itrdgavykqrfenggkpvttlkkigtalksktgtkvtfmpdatifsttdfkyntiserl
nesafllknvtlsltdkrtdeaiefhyen

Sequence, based on observed residues (ATOM records): (download)

>d5yiga_ d.122.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 760839]}
vlegldavrkrpgmyigstdgaglhhlvweivdnavdealsgfgdridvtinkdgsltvq
dhgrgmptgmhamgiptveviftilhavgssvvnalsswleveitrdgavykqrfenggk
pvttlkkigtalksktgtkvtfmpdatifsttdfkyntiserlnesafllknvtlsltdk
rtdeaiefhyen

SCOPe Domain Coordinates for d5yiga_:

Click to download the PDB-style file with coordinates for d5yiga_.
(The format of our PDB-style files is described here.)

Timeline for d5yiga_:

  • d5yiga_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-06