Lineage for d6gw9a_ (6gw9 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2373041Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2373045Protein Concanavalin A [49901] (4 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 2373058Species Canavalia cathartica [TaxId:28958] [224859] (2 PDB entries)
  8. 3057160Domain d6gw9a_: 6gw9 A: [357222]
    automated match to d5ygma_
    complexed with ca, mg

Details for d6gw9a_

PDB Entry: 6gw9 (more details), 2.1 Å

PDB Description: concanavalin a structure determined with data from the euxfel, the first mhz free electron laser
PDB Compounds: (A:) Concanavalin V

SCOPe Domain Sequences for d6gw9a_:

Sequence, based on SEQRES records: (download)

>d6gw9a_ b.29.1.1 (A:) Concanavalin A {Canavalia cathartica [TaxId: 28958]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d6gw9a_ b.29.1.1 (A:) Concanavalin A {Canavalia cathartica [TaxId: 28958]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksntn
alhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvhiwes
savvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d6gw9a_:

Click to download the PDB-style file with coordinates for d6gw9a_.
(The format of our PDB-style files is described here.)

Timeline for d6gw9a_:

  • d6gw9a_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-06