| Class g: Small proteins [56992] (98 folds) |
| Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.5: Rubredoxin-like [57802] (4 families) ![]() |
| Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins) membrane-anchored rubredoxin-like domain automatically mapped to Pfam PF01215 |
| Protein Cytochrome c oxidase Subunit F [57819] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [57820] (49 PDB entries) |
| Domain d5zcqf_: 5zcq F: [357219] Other proteins in same PDB: d5zcqb1, d5zcqb2, d5zcqc_, d5zcqo1, d5zcqo2, d5zcqp_, d5zcqt_, d5zcqu_, d5zcqv_, d5zcqw_, d5zcqx_, d5zcqy_, d5zcqz_ automated match to d1v54f_ complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5zcq (more details), 1.65 Å
SCOPe Domain Sequences for d5zcqf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zcqf_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah
Timeline for d5zcqf_: