Lineage for d6dwii2 (6dwi I:107-211)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (808 PDB entries)
  8. 3057155Domain d6dwii2: 6dwi I:107-211 [357217]
    Other proteins in same PDB: d6dwia1, d6dwic1, d6dwie1, d6dwig1, d6dwii1, d6dwik1, d6dwim1, d6dwio1
    automated match to d1dn0a2
    complexed with cl, flc, gol, hd4

Details for d6dwii2

PDB Entry: 6dwi (more details), 2.39 Å

PDB Description: structure of the 4462 antibody fab fragment bound to a staphylococcus aureus wall techoic acid analog
PDB Compounds: (I:) 4462 Fab Light Chain

SCOPe Domain Sequences for d6dwii2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dwii2 b.1.1.2 (I:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d6dwii2:

Click to download the PDB-style file with coordinates for d6dwii2.
(The format of our PDB-style files is described here.)

Timeline for d6dwii2:

  • d6dwii2 appears in periodic updates to SCOPe 2.07 starting on 2018-09-06