Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d6dwig1: 6dwi G:1-106 [357202] Other proteins in same PDB: d6dwia2, d6dwib1, d6dwib2, d6dwic2, d6dwid1, d6dwid2, d6dwie2, d6dwif1, d6dwif2, d6dwig2, d6dwih1, d6dwih2, d6dwii2, d6dwij_, d6dwik2, d6dwil_, d6dwim2, d6dwin1, d6dwin2, d6dwio2, d6dwip1, d6dwip2 automated match to d1dn0a1 complexed with cl, flc, gol, hd4 |
PDB Entry: 6dwi (more details), 2.39 Å
SCOPe Domain Sequences for d6dwig1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6dwig1 b.1.1.0 (G:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqmtqspatlsvspgetvtlscrasqsvrtnvawyrhkagqapmilvsgastrasgapa rfsgsgygteftltitslqsedfavyyclqyntwprtfgqgtkvev
Timeline for d6dwig1:
View in 3D Domains from other chains: (mouse over for more information) d6dwia1, d6dwia2, d6dwib1, d6dwib2, d6dwic1, d6dwic2, d6dwid1, d6dwid2, d6dwie1, d6dwie2, d6dwif1, d6dwif2, d6dwih1, d6dwih2, d6dwii1, d6dwii2, d6dwij_, d6dwik1, d6dwik2, d6dwil_, d6dwim1, d6dwim2, d6dwin1, d6dwin2, d6dwio1, d6dwio2, d6dwip1, d6dwip2 |