Lineage for d5otpb_ (5otp B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2544570Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 2544571Species Human (Homo sapiens) [TaxId:9606] [75559] (131 PDB entries)
  8. 3057131Domain d5otpb_: 5otp B: [357193]
    automated match to d3at4a_
    complexed with act, at8, dms

Details for d5otpb_

PDB Entry: 5otp (more details), 1.57 Å

PDB Description: the structure of cam4072 bound to ck2alpha
PDB Compounds: (B:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d5otpb_:

Sequence, based on SEQRES records: (download)

>d5otpb_ d.144.1.7 (B:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
gpvpsrarvytdvnthrpseywdyeshvvewgnqddyqlvrklgrgkysevfeainitnn
ekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdfk
qlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefy
hpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydql
vriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfld
kllrydhqsrltareamehpyfytv

Sequence, based on observed residues (ATOM records): (download)

>d5otpb_ d.144.1.7 (B:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
gpvpsrarvytdvnthrpseywdyeshvvewgnqddyqlvrklgrgkysevfeainitnn
ekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntltd
ydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefyhpgqeynv
rvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydqlvriakvlg
tedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfldkllrydhq
srltareamehpyfytv

SCOPe Domain Coordinates for d5otpb_:

Click to download the PDB-style file with coordinates for d5otpb_.
(The format of our PDB-style files is described here.)

Timeline for d5otpb_:

  • d5otpb_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-06