Lineage for d6dw2a1 (6dw2 A:1-106)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1083 PDB entries)
  8. 3057129Domain d6dw2a1: 6dw2 A:1-106 [357191]
    Other proteins in same PDB: d6dw2a2
    automated match to d1dn0a1
    complexed with hd4, mla, na

Details for d6dw2a1

PDB Entry: 6dw2 (more details), 1.7 Å

PDB Description: structure of the 6078 antibody fab fragment bound to a staphylococcus aureus wall techoic acid analog
PDB Compounds: (A:) 6078 Fab light chain

SCOPe Domain Sequences for d6dw2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dw2a1 b.1.1.0 (A:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspsilsasvgdrvtitcrasqtisgwlawyqqkpaeapklliykastlesgvps
rfsgsgsgteftltisslqpddfgiyycqqyksysfnfgqgtkvei

SCOPe Domain Coordinates for d6dw2a1:

Click to download the PDB-style file with coordinates for d6dw2a1.
(The format of our PDB-style files is described here.)

Timeline for d6dw2a1:

  • d6dw2a1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-06