Lineage for d6espa1 (6esp A:6-116)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2379659Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2379660Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2379661Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2379973Protein automated matches [190055] (6 species)
    not a true protein
  7. 2379982Species Human (Homo sapiens) [TaxId:9606] [187785] (44 PDB entries)
  8. 3057127Domain d6espa1: 6esp A:6-116 [357189]
    Other proteins in same PDB: d6espa2
    automated match to d2w4fa_

Details for d6espa1

PDB Entry: 6esp (more details)

PDB Description: proteome-wide analysis of phospho-regulated pdz domain interactions
PDB Compounds: (A:) Protein scribble homolog

SCOPe Domain Sequences for d6espa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6espa1 b.36.1.1 (A:6-116) automated matches {Homo sapiens [TaxId: 9606]}
parieeeeltltilrqtgglgisiaggkgstpykgddegifisrvseegpaaragvrvgd
kllevngvalqgaehheavealrgagtavqmrvwrermvepenavtitplr

SCOPe Domain Coordinates for d6espa1:

Click to download the PDB-style file with coordinates for d6espa1.
(The format of our PDB-style files is described here.)

Timeline for d6espa1:

  • d6espa1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-06

View in 3D
Domains from same chain:
(mouse over for more information)
d6espa2