Lineage for d5zurb_ (5zur B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312408Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2312409Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314636Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2314637Protein automated matches [190036] (45 species)
    not a true protein
  7. 3057106Species Achromobacter sp. [TaxId:1397275] [357168] (1 PDB entry)
  8. 3057126Domain d5zurb_: 5zur B: [357188]
    automated match to d3uoia_
    complexed with ba, cl, fe2, hem, peg

Details for d5zurb_

PDB Entry: 5zur (more details), 1.95 Å

PDB Description: achromobacter dh1f bacterioferritin
PDB Compounds: (B:) bacterioferritin

SCOPe Domain Sequences for d5zurb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zurb_ a.25.1.0 (B:) automated matches {Achromobacter sp. [TaxId: 1397275]}
mkgdktviqflnkqltneltainqyflharmlnhwgfdklgkheyeesigemkhadrlia
rifmldglpnlqdlhklligedvpellacdlkleqaahatvreaiahcesvrdyvsrdlf
qdilddteehidyletqidlidkvglqnylqsqms

SCOPe Domain Coordinates for d5zurb_:

Click to download the PDB-style file with coordinates for d5zurb_.
(The format of our PDB-style files is described here.)

Timeline for d5zurb_:

  • d5zurb_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-06