SCOPe 2.08: Domain d5zw0a2: 5zw0 A:231-382

Lineage for d5zw0a2 (5zw0 A:231-382)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (30 species)
   not a true protein

7. Species Serratia sp. [TaxId:104623] [357159] (5 PDB entries)

8. Domain d5zw0a2: 5zw0 A:231-382 [357178]
   Other proteins in same PDB: d5zw0a1, d5zw0b1
   automated match to d3mpia2

Details for d5zw0a2

PDB Entry: 5zw0, 2.54 Å

PDB Description: apo-form piga

PDB Compounds: (A:) L-prolyl-[peptidyl-carrier protein] dehydrogenase

SCOPe Domain Sequences for d5zw0a2:

Sequence; same for both SEQRES and ATOM records:

>d5zw0a2 a.29.3.0 (A:231-382) automated matches {Serratia sp. [TaxId: 104623]}
gaggaifhdsmiwekgclsalfvgglarllettleyakarqqfgkaigqfqsvsnriidm
klrleqcrlmlyracwkhdqgqdaeadiamsklliseyavqsgldaiqtfggaamdqelg
lvrhllnmipsrifsgtndiqkeiiarklglr

Timeline for d5zw0a2:

• d5zw0a2 first appeared in SCOPe 2.07