Class a: All alpha proteins [46456] (290 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
Protein automated matches [226935] (30 species) not a true protein |
Species Serratia sp. [TaxId:104623] [357159] (5 PDB entries) |
Domain d5zw0a2: 5zw0 A:231-382 [357178] Other proteins in same PDB: d5zw0a1, d5zw0b1 automated match to d3mpia2 |
PDB Entry: 5zw0 (more details), 2.54 Å
SCOPe Domain Sequences for d5zw0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zw0a2 a.29.3.0 (A:231-382) automated matches {Serratia sp. [TaxId: 104623]} gaggaifhdsmiwekgclsalfvgglarllettleyakarqqfgkaigqfqsvsnriidm klrleqcrlmlyracwkhdqgqdaeadiamsklliseyavqsgldaiqtfggaamdqelg lvrhllnmipsrifsgtndiqkeiiarklglr
Timeline for d5zw0a2: