Lineage for d5zw0a1 (5zw0 A:1-230)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2570412Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2570413Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2570558Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 2570559Protein automated matches [226934] (27 species)
    not a true protein
  7. 3057095Species Serratia sp. [TaxId:104623] [357157] (4 PDB entries)
  8. 3057115Domain d5zw0a1: 5zw0 A:1-230 [357177]
    Other proteins in same PDB: d5zw0a2, d5zw0b2
    automated match to d3mpia1

Details for d5zw0a1

PDB Entry: 5zw0 (more details), 2.54 Å

PDB Description: apo-form piga
PDB Compounds: (A:) L-prolyl-[peptidyl-carrier protein] dehydrogenase

SCOPe Domain Sequences for d5zw0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zw0a1 e.6.1.0 (A:1-230) automated matches {Serratia sp. [TaxId: 104623]}
mdfnlsnsqsdiyesayrfacdvldqdaqtrisqkilstelwkkaaaygfahgpvshqfg
gselgaldtalmiealgkgsrdiglsfslcahlcacviplyrfgsselkdkyleslvtgk
liaanaatepdagsdiynmqataqpceggyilngkkifitnapiadvfiiyaktnpdhgf
lgvsafliekgtpglnvgevipkdclsncpwseivfndifipqsqrigme

SCOPe Domain Coordinates for d5zw0a1:

Click to download the PDB-style file with coordinates for d5zw0a1.
(The format of our PDB-style files is described here.)

Timeline for d5zw0a1:

  • d5zw0a1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-06

View in 3D
Domains from same chain:
(mouse over for more information)
d5zw0a2