Lineage for d6m8za_ (6m8z A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2441326Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2441498Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 2441499Protein DJ-1 [89603] (1 species)
    RNA-binding protein regulatory subunit
  7. 2441500Species Human (Homo sapiens) [TaxId:9606] [89604] (61 PDB entries)
    Uniprot Q99497
  8. 3057108Domain d6m8za_: 6m8z A: [357170]
    automated match to d4s0za_
    complexed with cl, epe

Details for d6m8za_

PDB Entry: 6m8z (more details), 1.83 Å

PDB Description: crystal structure of human dj-1 without a modification on cys-106
PDB Compounds: (A:) Protein/nucleic acid deglycase DJ-1

SCOPe Domain Sequences for d6m8za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6m8za_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]}
askralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasleda
kkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgs
kvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqv
kaplvlk

SCOPe Domain Coordinates for d6m8za_:

Click to download the PDB-style file with coordinates for d6m8za_.
(The format of our PDB-style files is described here.)

Timeline for d6m8za_:

  • d6m8za_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-06