Lineage for d6fy2l1 (6fy2 L:2-107)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1083 PDB entries)
  8. 3057102Domain d6fy2l1: 6fy2 L:2-107 [357164]
    Other proteins in same PDB: d6fy2l2, d6fy2y2
    automated match to d1lila1
    complexed with gol, so4

Details for d6fy2l1

PDB Entry: 6fy2 (more details), 2.3 Å

PDB Description: crystal structure of a v2p-reactive rv144 vaccine-like antibody, cap228-16h, in complex with a heterologous cap225 v1v2
PDB Compounds: (L:) CAP228-16H Light Chain

SCOPe Domain Sequences for d6fy2l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fy2l1 b.1.1.0 (L:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yeltqppsvsvapgttatitcggvdigstlvhwyqqrpgqapllviyddsdrpsgiperf
sgsnsgnmatltisrveagdeadyycqvwhstsavifgggtkltvls

SCOPe Domain Coordinates for d6fy2l1:

Click to download the PDB-style file with coordinates for d6fy2l1.
(The format of our PDB-style files is described here.)

Timeline for d6fy2l1:

  • d6fy2l1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-06

View in 3D
Domains from same chain:
(mouse over for more information)
d6fy2l2