Lineage for d5zcqw_ (5zcq W:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2630532Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family) (S)
    automatically mapped to Pfam PF02238
  5. 2630533Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (2 proteins)
  6. 2630534Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 2630535Species Cow (Bos taurus) [TaxId:9913] [81416] (51 PDB entries)
  8. 2630565Domain d5zcqw_: 5zcq W: [357150]
    Other proteins in same PDB: d5zcqb1, d5zcqb2, d5zcqc_, d5zcqf_, d5zcqo1, d5zcqo2, d5zcqp_, d5zcqs_, d5zcqt_, d5zcqu_, d5zcqv_, d5zcqx_, d5zcqy_, d5zcqz_
    automated match to d1v54j_
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5zcqw_

PDB Entry: 5zcq (more details), 1.65 Å

PDB Description: azide-bound cytochrome c oxidase structure determined using the crystals exposed to 10 mm azide solution for 2 days
PDB Compounds: (W:) cytochrome c oxidase subunit 7a1, mitochondrial

SCOPe Domain Sequences for d5zcqw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zcqw_ f.23.4.1 (W:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]}
fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk

SCOPe Domain Coordinates for d5zcqw_:

Click to download the PDB-style file with coordinates for d5zcqw_.
(The format of our PDB-style files is described here.)

Timeline for d5zcqw_: