Lineage for d5otsa_ (5ots A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2544570Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 2544571Species Human (Homo sapiens) [TaxId:9606] [75559] (131 PDB entries)
  8. 3057084Domain d5otsa_: 5ots A: [357146]
    automated match to d3h30a_
    complexed with au2

Details for d5otsa_

PDB Entry: 5ots (more details), 1.9 Å

PDB Description: the structure of cam4682 bound to ck2alpha
PDB Compounds: (A:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d5otsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5otsa_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
gpvpsrarvytdvnthrpseywdyeshvvewgnqddyqlvrklgrgkysevfeainitnn
ekvvvkilkpvaaakikreikilenlrggpniitladivkdpvsrtpalvfehvnntdfk
qlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefy
hpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydql
vriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfld
kllrydhqsrltareamehpyfytvvk

SCOPe Domain Coordinates for d5otsa_:

Click to download the PDB-style file with coordinates for d5otsa_.
(The format of our PDB-style files is described here.)

Timeline for d5otsa_:

  • d5otsa_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-06