| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) ![]() automatically mapped to Pfam PF02937 |
| Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein) |
| Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
| Species Cow (Bos taurus) [TaxId:9913] [81412] (52 PDB entries) |
| Domain d5zcqv_: 5zcq V: [357144] Other proteins in same PDB: d5zcqb1, d5zcqb2, d5zcqc_, d5zcqf_, d5zcqo1, d5zcqo2, d5zcqp_, d5zcqs_, d5zcqt_, d5zcqu_, d5zcqw_, d5zcqx_, d5zcqy_, d5zcqz_ automated match to d1v54i_ complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5zcq (more details), 1.65 Å
SCOPe Domain Sequences for d5zcqv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zcqv_ f.23.3.1 (V:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]}
stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
eemrkagifqsak
Timeline for d5zcqv_: