Lineage for d5ourb_ (5our B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2888268Protein Uridine phosphorylase [53176] (6 species)
  7. 2888510Species Vibrio cholerae [TaxId:243277] [224899] (19 PDB entries)
  8. 2888578Domain d5ourb_: 5our B: [357140]
    automated match to d5efob_
    complexed with bje, cl, edo, gol, mg, na

Details for d5ourb_

PDB Entry: 5our (more details), 1.35 Å

PDB Description: x-ray structure uridine phosphorylase from vibrio cholerae in complex with 2,2'-anhydrouridine at 1.34 a.
PDB Compounds: (B:) Uridine phosphorylase

SCOPe Domain Sequences for d5ourb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ourb_ c.56.2.1 (B:) Uridine phosphorylase {Vibrio cholerae [TaxId: 243277]}
tktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsv
vvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslh
fapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqg
smkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsi
kvvveaarkmlk

SCOPe Domain Coordinates for d5ourb_:

Click to download the PDB-style file with coordinates for d5ourb_.
(The format of our PDB-style files is described here.)

Timeline for d5ourb_: