Lineage for d5z1xb3 (5z1x B:301-495)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2367979Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2367980Protein automated matches [190824] (24 species)
    not a true protein
  7. 3057059Species Cerrena sp. [TaxId:90311] [357121] (1 PDB entry)
  8. 3057072Domain d5z1xb3: 5z1x B:301-495 [357134]
    automated match to d1gyca3
    complexed with cu, gol, nag, oxy, so4

Details for d5z1xb3

PDB Entry: 5z1x (more details), 1.38 Å

PDB Description: crystal structure of laccase from cerrena sp. rsd1
PDB Compounds: (B:) laccase

SCOPe Domain Sequences for d5z1xb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z1xb3 b.6.1.0 (B:301-495) automated matches {Cerrena sp. [TaxId: 90311]}
qepnlrplvsmpvpgsatpggvdvvhnlilgfsagkftingaaftppsvpvllqilsgtt
naqdllpsgsvitlpigktieltlaagvlggphpfhlhghnfhvvrsagqttpnyvdpiv
rdvvntggtgdnvtirfttdnpgpwflhchidwhleagfavvfaegvnqtnaanptpadw
nnlcniynaladgdk

SCOPe Domain Coordinates for d5z1xb3:

Click to download the PDB-style file with coordinates for d5z1xb3.
(The format of our PDB-style files is described here.)

Timeline for d5z1xb3:

  • d5z1xb3 appears in periodic updates to SCOPe 2.07 starting on 2018-09-06