SCOPe 2.08: Domain d5yama1: 5yam A:2-69

Lineage for d5yama1 (5yam A:2-69)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families)
   form dimers with different dimerisation modes

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)

6. Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (2 species)
   has different dimerisation mode

7. Species Mouse (Mus musculus) [TaxId:10090] [419782] (1 PDB entry)

8. Domain d5yama1: 5yam A:2-69 [357127]
   Other proteins in same PDB: d5yama2, d5yamb2
   automated match to d1g91a_

Details for d5yama1

PDB Entry: 5yam

PDB Description: solution structure of mice met-ccl5/rantes

PDB Compounds: (A:) c-c motif chemokine 5

SCOPe Domain Sequences for d5yama1:

Sequence; same for both SEQRES and ATOM records:

>d5yama1 d.9.1.1 (A:2-69) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Mouse (Mus musculus) [TaxId: 10090]}
spygsdttpccfaylslalprahvkeyfytsskcsnlavvfvtrrnrqvcanpekkwvqe
yinylems

Timeline for d5yama1:

• d5yama1 first appeared in SCOPe 2.07