Lineage for d5yama1 (5yam A:2-69)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2499233Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2499234Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2499235Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2499552Protein automated matches [190403] (3 species)
    not a true protein
  7. 2499618Species Mouse (Mus musculus) [TaxId:10090] [188560] (2 PDB entries)
  8. 3057065Domain d5yama1: 5yam A:2-69 [357127]
    Other proteins in same PDB: d5yama2, d5yamb2
    automated match to d1g91a_

Details for d5yama1

PDB Entry: 5yam (more details)

PDB Description: solution structure of mice met-ccl5/rantes
PDB Compounds: (A:) c-c motif chemokine 5

SCOPe Domain Sequences for d5yama1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yama1 d.9.1.1 (A:2-69) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
spygsdttpccfaylslalprahvkeyfytsskcsnlavvfvtrrnrqvcanpekkwvqe
yinylems

SCOPe Domain Coordinates for d5yama1:

Click to download the PDB-style file with coordinates for d5yama1.
(The format of our PDB-style files is described here.)

Timeline for d5yama1:

  • d5yama1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-06

View in 3D
Domains from same chain:
(mouse over for more information)
d5yama2