Lineage for d5yb1a2 (5yb1 A:197-388)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2336647Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2336648Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2336649Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 2336650Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 2336651Species Human (Homo sapiens) [TaxId:9606] [48555] (80 PDB entries)
    Uniprot P02768 29-596
  8. 3057056Domain d5yb1a2: 5yb1 A:197-388 [357118]
    automated match to d3uiva1
    complexed with 8zr, plm

Details for d5yb1a2

PDB Entry: 5yb1 (more details), 2.62 Å

PDB Description: structure and function of human serum albumin-metal agent complex
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d5yb1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yb1a2 a.126.1.1 (A:197-388) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd
radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc
knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde
fkplveepqnli

SCOPe Domain Coordinates for d5yb1a2:

Click to download the PDB-style file with coordinates for d5yb1a2.
(The format of our PDB-style files is described here.)

Timeline for d5yb1a2:

  • d5yb1a2 appears in periodic updates to SCOPe 2.07 starting on 2018-09-06