Lineage for d5otjl1 (5otj L:1-112)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347244Species Human (Homo sapiens) [TaxId:9606] [188740] (194 PDB entries)
  8. 3057053Domain d5otjl1: 5otj L:1-112 [357115]
    Other proteins in same PDB: d5otja2, d5otjl2
    automated match to d1aqkl1
    complexed with ca, edo

Details for d5otjl1

PDB Entry: 5otj (more details), 2.35 Å

PDB Description: monomeric polcalcin (phl p 7) in complex with two identical allergen- specific antibodies
PDB Compounds: (L:) 102.1F10 Fab light chain

SCOPe Domain Sequences for d5otjl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5otjl1 b.1.1.1 (L:1-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esaltqppsvsgapgqrvsisctggssnfgagydvhwyqqlpatapklliygnnnrpsgv
pdrfsgsksgtsaslaitglqaedegdyfcqsfdtslsgwifgggtkltvlg

SCOPe Domain Coordinates for d5otjl1:

Click to download the PDB-style file with coordinates for d5otjl1.
(The format of our PDB-style files is described here.)

Timeline for d5otjl1:

  • d5otjl1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-06

View in 3D
Domains from same chain:
(mouse over for more information)
d5otjl2