Lineage for d6adib_ (6adi B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2479470Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2479471Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2479472Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2479631Protein automated matches [190072] (19 species)
    not a true protein
  7. 2479700Species Human (Homo sapiens) [TaxId:9606] [189131] (9 PDB entries)
  8. 3057051Domain d6adib_: 6adi B: [357113]
    Other proteins in same PDB: d6adia2
    automated match to d1lwda_
    complexed with 9uo, ndp

Details for d6adib_

PDB Entry: 6adi (more details), 1.97 Å

PDB Description: crystal structures of idh2 r140q in complex with ag-881
PDB Compounds: (B:) Isocitrate dehydrogenase [NADP], mitochondrial

SCOPe Domain Sequences for d6adib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6adib_ c.77.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rikvakpvvemdgdemtriiwqfikeklilphvdiqlkyfdlglpnrdqtddqvtidsal
atqkysvavkcatitpdearveefklkkmwkspngtiqnilggtvfrepiickniprlvp
gwtkpitigrhahgdqykatdfvadragtfkmvftpkdgsgvkewevynfpaggvgmgmy
ntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifdkhyktdfdknk
iwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdgkti
eaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqmlekvc
vetvesgamtkdlagcihglsnvklnehflnttdfldtiksnldral

SCOPe Domain Coordinates for d6adib_:

Click to download the PDB-style file with coordinates for d6adib_.
(The format of our PDB-style files is described here.)

Timeline for d6adib_:

  • d6adib_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-06