Lineage for d6gwaa_ (6gwa A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418280Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 2418453Protein Seed storage protein [51537] (2 species)
    close relation of hevamine, may bind chitin
  7. 2418454Species Jack bean (Canavalia ensiformis), Concanavalin B [TaxId:3823] [51539] (2 PDB entries)
  8. 3057049Domain d6gwaa_: 6gwa A: [357111]
    automated match to d1cnva_

Details for d6gwaa_

PDB Entry: 6gwa (more details), 2.1 Å

PDB Description: concanavalin b structure determined with data from the euxfel, the first mhz free electron laser
PDB Compounds: (A:) concanavalin b

SCOPe Domain Sequences for d6gwaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gwaa_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]}
dissteiavywgqredgllrdtcktnnykivfisfldkfgceirkpelelegvcgpsvgn
pcsflesqikecqrmgvkvflalggpkgtysacsadyakdlaeylhtyflserregplgk
valdgihfdiqkpvdelnwdnlleelyqikdvyqstfllsaapgclspdeyldnaiqtrh
fdyifvrfyndrscqystgniqrirnawlswtksvyprdknlflelpasqatapgggyip
psaligqvlpylpdlqtryagialwnrqadketgystniiryl

SCOPe Domain Coordinates for d6gwaa_:

Click to download the PDB-style file with coordinates for d6gwaa_.
(The format of our PDB-style files is described here.)

Timeline for d6gwaa_:

  • d6gwaa_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-06