Lineage for d5otna_ (5otn A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535539Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2535540Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2535541Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2535725Protein automated matches [190465] (6 species)
    not a true protein
  7. 2535775Species Zebrafish (Danio rerio) [TaxId:7955] [315259] (2 PDB entries)
  8. 3057041Domain d5otna_: 5otn A: [357103]
    automated match to d5hzxa_
    complexed with 6og, ca, cl, edo, gol

Details for d5otna_

PDB Entry: 5otn (more details), 0.99 Å

PDB Description: crystal structure of zebrafish mth1 in complex with o6-methyl-dgmp
PDB Compounds: (A:) Nudix (Nucleoside diphosphate linked moiety X)-type motif 1

SCOPe Domain Sequences for d5otna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5otna_ d.113.1.1 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
mftsklltlvlvvqpgrvllgmkkrgfgagkwngfggkvqtgetieqaarrelleesglt
vdtlhkignikfefigetelmdvhifradnyegepaesdemrpqwfdidkipfsqmwadd
ilwfplmlqkkrflgyfkfqghdvivehkldevedl

SCOPe Domain Coordinates for d5otna_:

Click to download the PDB-style file with coordinates for d5otna_.
(The format of our PDB-style files is described here.)

Timeline for d5otna_:

  • d5otna_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-06