Lineage for d2lbpa_ (2lbp A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 845996Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 845997Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 845998Family c.93.1.1: L-arabinose binding protein-like [53823] (16 proteins)
  6. 846129Protein Leucine-binding protein [53843] (1 species)
  7. 846130Species Escherichia coli [TaxId:562] [53844] (4 PDB entries)
  8. 846138Domain d2lbpa_: 2lbp A: [35709]

Details for d2lbpa_

PDB Entry: 2lbp (more details), 2.4 Å

PDB Description: structure of the l-leucine-binding protein refined at 2.4 angstroms resolution and comparison with the leu(slash)ile(slash)val-binding protein structure
PDB Compounds: (A:) leucine-binding protein

SCOP Domain Sequences for d2lbpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lbpa_ c.93.1.1 (A:) Leucine-binding protein {Escherichia coli [TaxId: 562]}
ddikvavvgamsgpiaqwgimefngaeqaikdinakggikgdklvgveyddacdpkqava
vankivndgikyvighlcssstqpasdiyedegilmispgatapeltqrgyqhimrtagl
dssqgptaakyiletvkpqriaiihdkqqygeglarsvqdglkaananvvffdgitagek
dfsaliarlkkenidfvyyggyypemgqmlrqarsvglktqfmgpegvgnaslsniagda
aegmlvtmpkrydqdpanqgivdalkadkkdpsgpyvwityaavqslatalertgsdepl
alvkdlkangantvigplnwdekgdlkgfdfgvfqwhadgsstkak

SCOP Domain Coordinates for d2lbpa_:

Click to download the PDB-style file with coordinates for d2lbpa_.
(The format of our PDB-style files is described here.)

Timeline for d2lbpa_: