Lineage for d5ou7c1 (5ou7 C:2-88)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1083 PDB entries)
  8. 3057023Domain d5ou7c1: 5ou7 C:2-88 [357085]
    Other proteins in same PDB: d5ou7c3, d5ou7d3
    automated match to d1ucta1
    complexed with cl, nag, pg6, po4; mutant

Details for d5ou7c1

PDB Entry: 5ou7 (more details), 1.9 Å

PDB Description: crystal structure of the glycoprotein vi loop truncation mutant pavs- papykn
PDB Compounds: (C:) Platelet glycoprotein VI

SCOPe Domain Sequences for d5ou7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ou7c1 b.1.1.0 (C:2-88) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sgplpkpslqalpsslvplekpvtlrcqgppgvdlyrleklsssryqdqavlfipamkrs
lagryrcsyqngslwslpsdqlelvat

SCOPe Domain Coordinates for d5ou7c1:

Click to download the PDB-style file with coordinates for d5ou7c1.
(The format of our PDB-style files is described here.)

Timeline for d5ou7c1:

  • d5ou7c1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-06