Lineage for d6maia_ (6mai A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2406647Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2406808Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2407003Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2407004Protein automated matches [191182] (17 species)
    not a true protein
  7. 3057021Species Legionella pneumophila [TaxId:272624] [357083] (2 PDB entries)
  8. 3057022Domain d6maia_: 6mai A: [357084]
    automated match to d5nz2a_
    complexed with edo

Details for d6maia_

PDB Entry: 6mai (more details), 1.8 Å

PDB Description: crystal structure of deoxyuridine 5'-triphosphate nucleotidohydrolase from legionella pneumophila philadelphia 1
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d6maia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6maia_ b.85.4.0 (A:) automated matches {Legionella pneumophila [TaxId: 272624]}
hqviqlkildsrigdtiplpayatdgsagldlrvcisepmqvapqqtvllptgiaiyiad
pklaavilprsglghkngivlgnlvglidsdyqgelkiscwnrsqehftvnpgdriaqlv
fipvvqasfevvnefte

SCOPe Domain Coordinates for d6maia_:

Click to download the PDB-style file with coordinates for d6maia_.
(The format of our PDB-style files is described here.)

Timeline for d6maia_:

  • d6maia_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-06