Lineage for d5omea_ (5ome A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641212Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2641213Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 2641222Protein Rubredoxin [57804] (8 species)
  7. 2641286Species Pyrococcus furiosus [TaxId:2261] [57809] (30 PDB entries)
    Uniprot P24297
  8. 2641288Domain d5omea_: 5ome A: [357080]
    automated match to d1bq8a_
    complexed with fe, na, po4

Details for d5omea_

PDB Entry: 5ome (more details), 0.75 Å

PDB Description: the cryofrozen atomic resolution x-ray crystal structure of the reduced form (fe2+) perdeuterated pyrococcus furiosus rubredoxin in d2o (100k, 0.75 angstrom resolution)
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d5omea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5omea_ g.41.5.1 (A:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]}
makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled

SCOPe Domain Coordinates for d5omea_:

Click to download the PDB-style file with coordinates for d5omea_.
(The format of our PDB-style files is described here.)

Timeline for d5omea_: