SCOP 1.65: Domain d2liv__: 2liv -

Lineage for d2liv__ (2liv -)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (13 proteins)

6. Protein Leucine-,isoleucine-,valine-binding (LIV) protein [53841] (1 species)

7. Species Escherichia coli [TaxId:562] [53842] (1 PDB entry)

8. Domain d2liv__: 2liv - [35708]

Details for d2liv__

PDB Entry: 2liv, 2.4 Å

PDB Description: periplasmic binding protein structure and function. refined x-ray structures of the leucine/isoleucine/valine-binding protein and its complex with leucine

SCOP Domain Sequences for d2liv__:

Sequence; same for both SEQRES and ATOM records:

>d2liv__ c.93.1.1 (-) Leucine-,isoleucine-,valine-binding (LIV) protein {Escherichia coli}
edikvavvgamsgpvaqygdqeftgaeqavadinakggikgnklqiakyddacdpkqava
vankvvndgikyvighlcssstqpasdiyedegilmitpaatapeltargyqlilrttgl
dsdqgptaakyilekvkpqriaivhdkqqygeglaravqdglkkgnanvvffdgitagek
dfstlvarlkkenidfvyyggyhpemgqilrqaraaglktqfmgpegvanvslsniages
aegllvtkpknydqvpankpivdaikakkqdpsgafvwttyaalqslqaglnqsddpaei
akylkansvdtvmgpltwdekgdlkgfefgvfdwhangtatdak

Timeline for d2liv__:

• d2liv__ first appeared (with stable ids) in SCOP 1.55
  
• d2liv__ appears in SCOP 1.63
  
• d2liv__ appears in SCOP 1.67
  
• d2liv__ appears in the current release, SCOPe 2.08, called d2liva_