Lineage for d2liv__ (2liv -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 28022Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
  4. 28023Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
  5. 28024Family c.93.1.1: L-arabinose binding protein-like [53823] (12 proteins)
  6. 28090Protein Leucine-,isoleucine-,valine-binding (LIV) protein [53841] (1 species)
  7. 28091Species Escherichia coli [TaxId:562] [53842] (1 PDB entry)
  8. 28092Domain d2liv__: 2liv - [35708]

Details for d2liv__

PDB Entry: 2liv (more details), 2.4 Å

PDB Description: periplasmic binding protein structure and function. refined x-ray structures of the leucine/isoleucine/valine-binding protein and its complex with leucine

SCOP Domain Sequences for d2liv__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2liv__ c.93.1.1 (-) Leucine-,isoleucine-,valine-binding (LIV) protein {Escherichia coli}
edikvavvgamsgpvaqygdqeftgaeqavadinakggikgnklqiakyddacdpkqava
vankvvndgikyvighlcssstqpasdiyedegilmitpaatapeltargyqlilrttgl
dsdqgptaakyilekvkpqriaivhdkqqygeglaravqdglkkgnanvvffdgitagek
dfstlvarlkkenidfvyyggyhpemgqilrqaraaglktqfmgpegvanvslsniages
aegllvtkpknydqvpankpivdaikakkqdpsgafvwttyaalqslqaglnqsddpaei
akylkansvdtvmgpltwdekgdlkgfefgvfdwhangtatdak

SCOP Domain Coordinates for d2liv__:

Click to download the PDB-style file with coordinates for d2liv__.
(The format of our PDB-style files is described here.)

Timeline for d2liv__: