Lineage for d6gaqb_ (6gaq B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2439108Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2439628Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2439629Protein automated matches [190158] (29 species)
    not a true protein
  7. 3054461Species Bacillus cereus [TaxId:226900] [354523] (3 PDB entries)
  8. 3057012Domain d6gaqb_: 6gaq B: [357074]
    automated match to d5ljia_
    complexed with ca, fmn, na, pg4

Details for d6gaqb_

PDB Entry: 6gaq (more details), 2.5 Å

PDB Description: crystal structure of oxidised flavodoxin 2 from bacillus cereus
PDB Compounds: (B:) flavodoxin

SCOPe Domain Sequences for d6gaqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gaqb_ c.23.5.0 (B:) automated matches {Bacillus cereus [TaxId: 226900]}
akiliayasmsgntesiadlikvsldafdhevvlqemegmdaeellaydgiilgsytwgd
gelpfeaedfhddlenidlagkkvavfgsgdtayelfceavtifeerlvergaelvqegl
kielapedeedvekcsnfaiafaekf

SCOPe Domain Coordinates for d6gaqb_:

Click to download the PDB-style file with coordinates for d6gaqb_.
(The format of our PDB-style files is described here.)

Timeline for d6gaqb_:

  • d6gaqb_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-06