SCOPe 2.01: Domain d1bykb_: 1byk B:

Lineage for d1bykb_ (1byk B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins)

6. Protein Trehalose repressor, C-terminal domain [53839] (1 species)

7. Species Escherichia coli [TaxId:562] [53840] (1 PDB entry)

8. Domain d1bykb_: 1byk B: [35707]
   complexed with t6p

Details for d1bykb_

PDB Entry: 1byk, 2.5 Å

PDB Description: trehalose repressor from escherichia coli

PDB Compounds: (B:) protein (trehalose operon repressor)

SCOPe Domain Sequences for d1bykb_:

Sequence; same for both SEQRES and ATOM records:

>d1bykb_ c.93.1.1 (B:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]}
sdkvvaiivtrldslsenlavqtmlpafyeqgydpimmesqfspqlvaehlgvlkrrnid
gvvlfgftgiteemlahwqsslvllardakgfasvcyddegaikilmqrlydqghrnisy
lgvphsdvttgkrrheaylafckahklhpvaalpglamkqgyenvakvitpettallcat
dtlalgaskylqeqridtlqlasvgntplmkflhpeivtvdpgyaeagrqaacqliaqvt
grsepqqiiipatls

Timeline for d1bykb_:

• d1bykb_ first appeared (with stable ids) in SCOP 1.55
  
• d1bykb_ appears in SCOP 1.75
  
• d1bykb_ appears in SCOPe 2.02
  
• d1bykb_ appears in the current release, SCOPe 2.08