Lineage for d6dg1a1 (6dg1 A:94-194)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2518968Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2519561Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2519562Protein automated matches [190896] (11 species)
    not a true protein
  7. 2519599Species Human (Homo sapiens) [TaxId:9606] [188315] (90 PDB entries)
  8. 3057007Domain d6dg1a1: 6dg1 A:94-194 [357069]
    Other proteins in same PDB: d6dg1a2
    automated match to d2kg0a_

Details for d6dg1a1

PDB Entry: 6dg1 (more details)

PDB Description: nmr structure of the second qrrm2 domain of human hnrnp h
PDB Compounds: (A:) qRRM2 domain of Heterogeneous nuclear ribonucleoprotein H2

SCOPe Domain Sequences for d6dg1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dg1a1 d.58.7.0 (A:94-194) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dwvlkhtgpnspdtandgfvrlrglpfgcskeeivqffsgleivpngitlpvdfqgrstg
eafvqfasqeiaekalkkhkerighryieifkssraevrth

SCOPe Domain Coordinates for d6dg1a1:

Click to download the PDB-style file with coordinates for d6dg1a1.
(The format of our PDB-style files is described here.)

Timeline for d6dg1a1:

  • d6dg1a1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-06

View in 3D
Domains from same chain:
(mouse over for more information)
d6dg1a2