Lineage for d6manb3 (6man B:249-379)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977231Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2977232Protein automated matches [226907] (28 species)
    not a true protein
  7. 2977447Species Rickettsia bellii [TaxId:336407] [357064] (1 PDB entry)
  8. 2977453Domain d6manb3: 6man B:249-379 [357068]
    Other proteins in same PDB: d6mana4, d6manb4
    automated match to d5w7za3
    complexed with edo, scn

Details for d6manb3

PDB Entry: 6man (more details), 2.35 Å

PDB Description: crystal structure of a dnan sliding clamp dna polymerase iii subunit beta from rickettsia bellii rml369-c
PDB Compounds: (B:) Beta sliding clamp

SCOPe Domain Sequences for d6manb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6manb3 d.131.1.0 (B:249-379) automated matches {Rickettsia bellii [TaxId: 336407]}
ssfipensssklvinrkifadtieriaiitvekfravklslsgealeisaigeargnake
vinssketenfyeysgetnldigfnpqyledvlkaiksdlvelyfssvsapvlikfpesp
kdifvvmpvkv

SCOPe Domain Coordinates for d6manb3:

Click to download the PDB-style file with coordinates for d6manb3.
(The format of our PDB-style files is described here.)

Timeline for d6manb3: