Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
Protein automated matches [226907] (28 species) not a true protein |
Species Rickettsia bellii [TaxId:336407] [357064] (1 PDB entry) |
Domain d6manb3: 6man B:249-379 [357068] Other proteins in same PDB: d6mana4, d6manb4 automated match to d5w7za3 complexed with edo, scn |
PDB Entry: 6man (more details), 2.35 Å
SCOPe Domain Sequences for d6manb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6manb3 d.131.1.0 (B:249-379) automated matches {Rickettsia bellii [TaxId: 336407]} ssfipensssklvinrkifadtieriaiitvekfravklslsgealeisaigeargnake vinssketenfyeysgetnldigfnpqyledvlkaiksdlvelyfssvsapvlikfpesp kdifvvmpvkv
Timeline for d6manb3:
View in 3D Domains from other chains: (mouse over for more information) d6mana1, d6mana2, d6mana3, d6mana4 |