Lineage for d6manb1 (6man B:1-122)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2539893Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2539894Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2540275Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2540276Protein automated matches [226907] (24 species)
    not a true protein
  7. 3057002Species Rickettsia bellii [TaxId:336407] [357064] (1 PDB entry)
  8. 3057004Domain d6manb1: 6man B:1-122 [357066]
    Other proteins in same PDB: d6mana4, d6manb4
    automated match to d5w7za1
    complexed with edo, scn

Details for d6manb1

PDB Entry: 6man (more details), 2.35 Å

PDB Description: crystal structure of a dnan sliding clamp dna polymerase iii subunit beta from rickettsia bellii rml369-c
PDB Compounds: (B:) Beta sliding clamp

SCOPe Domain Sequences for d6manb1:

Sequence, based on SEQRES records: (download)

>d6manb1 d.131.1.0 (B:1-122) automated matches {Rickettsia bellii [TaxId: 336407]}
mlkvivetktlvqalgfassvvekrniiselanikllakdgllelsstnmdlylsqkigv
qvvsegeltvstktlndivkklpdseltltdlgttgleitgkncrfnlftlpvesfpvmd
ni

Sequence, based on observed residues (ATOM records): (download)

>d6manb1 d.131.1.0 (B:1-122) automated matches {Rickettsia bellii [TaxId: 336407]}
mlkvivetktlvqalgfassvveanikllakdgllelsstnmdlylsqkigvqvvsegel
tvstktlndivkklpdseltltdlgttgleitgkncrfnlftlpvesfpvmdni

SCOPe Domain Coordinates for d6manb1:

Click to download the PDB-style file with coordinates for d6manb1.
(The format of our PDB-style files is described here.)

Timeline for d6manb1:

  • d6manb1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-06