Lineage for d1byka_ (1byk A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 28022Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
  4. 28023Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
  5. 28024Family c.93.1.1: L-arabinose binding protein-like [53823] (12 proteins)
  6. 28127Protein Trehalose repressor, C-terminal domain [53839] (1 species)
  7. 28128Species Escherichia coli [TaxId:562] [53840] (1 PDB entry)
  8. 28129Domain d1byka_: 1byk A: [35706]

Details for d1byka_

PDB Entry: 1byk (more details), 2.5 Å

PDB Description: trehalose repressor from escherichia coli

SCOP Domain Sequences for d1byka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli}
sdkvvaiivtrldslsenlavqtmlpafyeqgydpimmesqfspqlvaehlgvlkrrnid
gvvlfgftgiteemlahwqsslvllardakgfasvcyddegaikilmqrlydqghrnisy
lgvphsdvttgkrrheaylafckahklhpvaalpglamkqgyenvakvitpettallcat
dtlalgaskylqeqridtlqlasvgntplmkflhpeivtvdpgyaeagrqaacqliaqvt
grsepqqiiipatls

SCOP Domain Coordinates for d1byka_:

Click to download the PDB-style file with coordinates for d1byka_.
(The format of our PDB-style files is described here.)

Timeline for d1byka_: