Lineage for d1byka_ (1byk A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2912919Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913152Protein Trehalose repressor, C-terminal domain [53839] (2 species)
  7. 2913153Species Escherichia coli [TaxId:562] [53840] (1 PDB entry)
  8. 2913154Domain d1byka_: 1byk A: [35706]
    complexed with t6p

Details for d1byka_

PDB Entry: 1byk (more details), 2.5 Å

PDB Description: trehalose repressor from escherichia coli
PDB Compounds: (A:) protein (trehalose operon repressor)

SCOPe Domain Sequences for d1byka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]}
sdkvvaiivtrldslsenlavqtmlpafyeqgydpimmesqfspqlvaehlgvlkrrnid
gvvlfgftgiteemlahwqsslvllardakgfasvcyddegaikilmqrlydqghrnisy
lgvphsdvttgkrrheaylafckahklhpvaalpglamkqgyenvakvitpettallcat
dtlalgaskylqeqridtlqlasvgntplmkflhpeivtvdpgyaeagrqaacqliaqvt
grsepqqiiipatls

SCOPe Domain Coordinates for d1byka_:

Click to download the PDB-style file with coordinates for d1byka_.
(The format of our PDB-style files is described here.)

Timeline for d1byka_: