Lineage for d6e4fa_ (6e4f A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (17 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (660 PDB entries)
  8. 3056992Domain d6e4fa_: 6e4f A: [357054]
    automated match to d5j87b_
    complexed with edo, hra, imd

Details for d6e4fa_

PDB Entry: 6e4f (more details), 1.15 Å

PDB Description: crystal structure of arq 531 in complex with the kinase domain of btk
PDB Compounds: (A:) Tyrosine-protein kinase BTK

SCOPe Domain Sequences for d6e4fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e4fa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glgygsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakv
mmnlsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvcea
meyleskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppev
lmyskfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvyt
imyscwhekaderptfkillsnildvmdee

SCOPe Domain Coordinates for d6e4fa_:

Click to download the PDB-style file with coordinates for d6e4fa_.
(The format of our PDB-style files is described here.)

Timeline for d6e4fa_:

  • d6e4fa_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-06