SCOP 1.69: Domain d1lbgd2: 1lbg D:61-357

Lineage for d1lbgd2 (1lbg D:61-357)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (14 proteins)

6. Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species)

7. Species Escherichia coli [TaxId:562] [53838] (8 PDB entries)

8. Domain d1lbgd2: 1lbg D:61-357 [35705]
   Other proteins in same PDB: d1lbga1, d1lbgb1, d1lbgc1, d1lbgd1

Details for d1lbgd2

PDB Entry: 1lbg, 4.8 Å

PDB Description: lactose operon repressor bound to 21-base pair symmetric operator dna, alpha carbons only

SCOP Domain Sequences for d1lbgd2:

Sequence; same for both SEQRES and ATOM records:

>d1lbgd2 c.93.1.1 (D:61-357) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli}
slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle

Timeline for d1lbgd2:

• d1lbgd2 first appeared (with stable ids) in SCOP 1.55
  
• d1lbgd2 appears in SCOP 1.67
  
• d1lbgd2 appears in SCOP 1.71
  
• d1lbgd2 appears in the current release, SCOPe 2.08