Lineage for d6fy3y2 (6fy3 Y:108-206)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (808 PDB entries)
  8. 3056984Domain d6fy3y2: 6fy3 Y:108-206 [357046]
    Other proteins in same PDB: d6fy3l1, d6fy3y1
    automated match to d1lila2

Details for d6fy3y2

PDB Entry: 6fy3 (more details), 2.6 Å

PDB Description: crystal structure of a v2-directed, rv144 vaccine-like antibody from hiv-1 infection, cap228-3d, bound to a heterologous v2 peptide
PDB Compounds: (Y:) CAP228-3D Light Chain

SCOPe Domain Sequences for d6fy3y2:

Sequence, based on SEQRES records: (download)

>d6fy3y2 b.1.1.2 (Y:108-206) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektv

Sequence, based on observed residues (ATOM records): (download)

>d6fy3y2 b.1.1.2 (Y:108-206) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfpatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
lsltpeqwkshrsyscqvthegstvektv

SCOPe Domain Coordinates for d6fy3y2:

Click to download the PDB-style file with coordinates for d6fy3y2.
(The format of our PDB-style files is described here.)

Timeline for d6fy3y2:

  • d6fy3y2 appears in periodic updates to SCOPe 2.07 starting on 2018-09-06

View in 3D
Domains from same chain:
(mouse over for more information)
d6fy3y1