SCOPe 2.08: Domain d6dwia2: 6dwi A:107-211

Lineage for d6dwia2 (6dwi A:107-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6dwia2: 6dwi A:107-211 [357021]
   Other proteins in same PDB: d6dwia1, d6dwib1, d6dwib2, d6dwic1, d6dwid1, d6dwid2, d6dwie1, d6dwif1, d6dwif2, d6dwig1, d6dwih1, d6dwih2, d6dwii1, d6dwij_, d6dwik1, d6dwil_, d6dwim1, d6dwin1, d6dwin2, d6dwio1, d6dwip1, d6dwip2
   automated match to d1dn0a2
   complexed with cl, flc, gol, hd4

Details for d6dwia2

PDB Entry: 6dwi, 2.39 Å

PDB Description: structure of the 4462 antibody fab fragment bound to a staphylococcus aureus wall techoic acid analog

PDB Compounds: (A:) 4462 Fab Light Chain

SCOPe Domain Sequences for d6dwia2:

Sequence; same for both SEQRES and ATOM records:

>d6dwia2 b.1.1.2 (A:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d6dwia2:

• d6dwia2 first appeared in SCOPe 2.07