Lineage for d6d2oa1 (6d2o A:4-211)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460607Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2460672Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) (S)
  5. 2460790Family c.53.2.0: automated matches [191506] (1 protein)
    not a true family
  6. 2460791Protein automated matches [190830] (10 species)
    not a true protein
  7. 2460838Species Pseudomonas aeruginosa [TaxId:287] [278536] (5 PDB entries)
  8. 3056954Domain d6d2oa1: 6d2o A:4-211 [357016]
    Other proteins in same PDB: d6d2oa2
    automated match to d5jj8a_
    complexed with 4mz, zn

Details for d6d2oa1

PDB Entry: 6d2o (more details), 1.9 Å

PDB Description: beta carbonic anhydrase in complex with 4-methylimidazole
PDB Compounds: (A:) carbonic anhydrase

SCOPe Domain Sequences for d6d2oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d2oa1 c.53.2.0 (A:4-211) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
lqqlfennvrwaeaikqedpdffaklarqqtpeylwigcsdarvpaneivgmlpgdlfvh
rnvanvvlhtdlnclsviqfavdvlkvkhilvtghygcggvraslhndqlglidgwlrsi
rdlayeyrehleqlpteeervdrlcelnviqqvanvshtsivqnawhrgqslsvhgciyg
ikdglwknlnvtvsgldqlppqyrlspl

SCOPe Domain Coordinates for d6d2oa1:

Click to download the PDB-style file with coordinates for d6d2oa1.
(The format of our PDB-style files is described here.)

Timeline for d6d2oa1:

  • d6d2oa1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-06

View in 3D
Domains from same chain:
(mouse over for more information)
d6d2oa2