Lineage for d6d9ia_ (6d9i A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2495000Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2495001Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2495039Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2496184Protein automated matches [190299] (8 species)
    not a true protein
  7. 2496213Species Duck (Anas platyrhynchos) [TaxId:8839] [341650] (7 PDB entries)
  8. 3056949Domain d6d9ia_: 6d9i A: [357011]
    automated match to d5v92a_
    complexed with cl, mg

Details for d6d9ia_

PDB Entry: 6d9i (more details), 1.15 Å

PDB Description: pekin duck egg lysozyme isoform ii (del-ii)
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d6d9ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d9ia_ d.2.1.2 (A:) automated matches {Duck (Anas platyrhynchos) [TaxId: 8839]}
kvysrcelaaamkrlgldnyrgyslgnwvcaanyesgfntqatnrntdgstdygilqins
rwwcddgktprsknacgipcsvllrsditeavrcakrivsdgngmnawvawrnrcrgtdv
skwirgcrl

SCOPe Domain Coordinates for d6d9ia_:

Click to download the PDB-style file with coordinates for d6d9ia_.
(The format of our PDB-style files is described here.)

Timeline for d6d9ia_:

  • d6d9ia_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-06