Lineage for d1lbhd_ (1lbh D:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710422Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 710423Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 710424Family c.93.1.1: L-arabinose binding protein-like [53823] (15 proteins)
  6. 710518Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species)
  7. 710519Species Escherichia coli [TaxId:562] [53838] (10 PDB entries)
  8. 710538Domain d1lbhd_: 1lbh D: [35701]
    complexed with ipt

Details for d1lbhd_

PDB Entry: 1lbh (more details), 3.2 Å

PDB Description: intact lactose operon repressor with gratuitous inducer iptg
PDB Compounds: (D:) intact lactose operon repressor with gratuitous inducer iptg

SCOP Domain Sequences for d1lbhd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lbhd_ c.93.1.1 (D:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]}
lligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvsg
liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
drllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle

SCOP Domain Coordinates for d1lbhd_:

Click to download the PDB-style file with coordinates for d1lbhd_.
(The format of our PDB-style files is described here.)

Timeline for d1lbhd_: