Lineage for d1lbhc_ (1lbh C:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75160Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
  4. 75161Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
  5. 75162Family c.93.1.1: L-arabinose binding protein-like [53823] (12 proteins)
  6. 75211Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species)
  7. 75212Species Escherichia coli [TaxId:562] [53838] (5 PDB entries)
  8. 75226Domain d1lbhc_: 1lbh C: [35700]

Details for d1lbhc_

PDB Entry: 1lbh (more details), 3.2 Å

PDB Description: intact lactose operon repressor with gratuitous inducer iptg

SCOP Domain Sequences for d1lbhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lbhc_ c.93.1.1 (C:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli}
lligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvsg
liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
drllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle

SCOP Domain Coordinates for d1lbhc_:

Click to download the PDB-style file with coordinates for d1lbhc_.
(The format of our PDB-style files is described here.)

Timeline for d1lbhc_: