Lineage for d6ahib_ (6ahi B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2480698Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2480699Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2481051Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2481052Protein automated matches [190215] (33 species)
    not a true protein
  7. 2481107Species Helicobacter pylori [TaxId:85962] [229231] (4 PDB entries)
  8. 3056923Domain d6ahib_: 6ahi B: [356986]
    automated match to d4i1xa_
    complexed with met

Details for d6ahib_

PDB Entry: 6ahi (more details), 1.9 Å

PDB Description: crystal structure of o-acetylserine dependent cystathionine beta- synthase from helicobacter pylori.
PDB Compounds: (B:) Cysteine synthase

SCOPe Domain Sequences for d6ahib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ahib_ c.79.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]}
mmiittmqdaigrtpvfkftnkdypiplnsaiyaklehlnpggsvkdrlgqyligegfkt
gkitskttiieptagntgialalvaikhhlktifvvpekfstekqqimralgalvintpt
segisgaikkskelaesipdsylplqfenpdnpaayyhtlapeivqelgtnltsfvagig
sggtfagtarylkeripairligvepegsilnggepgpheiegigvefippffenldidg
fetisdeegfsytrklakkngllvgsssgaafvaalkeaqrlpegsqvltifpdvadryl
skgiyl

SCOPe Domain Coordinates for d6ahib_:

Click to download the PDB-style file with coordinates for d6ahib_.
(The format of our PDB-style files is described here.)

Timeline for d6ahib_:

  • d6ahib_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-06