Lineage for d6adgc_ (6adg C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2479470Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2479471Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2479472Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2479631Protein automated matches [190072] (19 species)
    not a true protein
  7. 2479700Species Human (Homo sapiens) [TaxId:9606] [189131] (9 PDB entries)
  8. 3056922Domain d6adgc_: 6adg C: [356984]
    automated match to d1t0la_
    complexed with 9uo, mg, ndp

Details for d6adgc_

PDB Entry: 6adg (more details), 3 Å

PDB Description: crystal structures of idh1 r132h in complex with ag-881
PDB Compounds: (C:) isocitrate dehydrogenase [nadp] cytoplasmic

SCOPe Domain Sequences for d6adgc_:

Sequence, based on SEQRES records: (download)

>d6adgc_ c.77.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkdaae
aikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvs
gwvkpiiighhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvamgm
ynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfeaq
kiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdgkt
veaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanaleev
sietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqak

Sequence, based on observed residues (ATOM records): (download)

>d6adgc_ c.77.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkdaae
aikkhnvgvkcangtirnilggtvfreaiickniprlvsgwvkpiiighhaygdqyratd
fvvpgpgkveitytpsdgtqkvtylvhnfeegggvamgmynqdksiedfahssfqmalsk
gwplylstkntilkkydgrfkdifqeiydkqyksqfeaqkiwyehrliddmvaqamkseg
gfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdgktveaeaahgtvtrhyrmyqkgq
etstnpiasifawtrglahrakldnnkelaffanaleevsietieagfmtkdlaacikgl
pnvqrsdylntfefmdklgenlkiklaqak

SCOPe Domain Coordinates for d6adgc_:

Click to download the PDB-style file with coordinates for d6adgc_.
(The format of our PDB-style files is described here.)

Timeline for d6adgc_:

  • d6adgc_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-06