Lineage for d5zlpf1 (5zlp F:7-110)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2504004Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) (S)
    automatically mapped to Pfam PF03951
  5. 2504129Family d.15.9.0: automated matches [227156] (1 protein)
    not a true family
  6. 2504130Protein automated matches [226862] (5 species)
    not a true protein
  7. 3056839Species Helicobacter pylori [TaxId:85962] [356901] (2 PDB entries)
  8. 3056920Domain d5zlpf1: 5zlp F:7-110 [356982]
    Other proteins in same PDB: d5zlpa2, d5zlpb2, d5zlpc2, d5zlpd2, d5zlpe2, d5zlpf2, d5zlpg2, d5zlph2, d5zlpi2, d5zlpj2, d5zlpk2, d5zlpl2
    automated match to d1htoa1
    complexed with adp, atp, mg, p3p, ppq

Details for d5zlpf1

PDB Entry: 5zlp (more details), 2.93 Å

PDB Description: crystal structure of glutamine synthetase from helicobacter pylori
PDB Compounds: (F:) glutamine synthetase

SCOPe Domain Sequences for d5zlpf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zlpf1 d.15.9.0 (F:7-110) automated matches {Helicobacter pylori [TaxId: 85962]}
nseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfdascfkg
wqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpy

SCOPe Domain Coordinates for d5zlpf1:

Click to download the PDB-style file with coordinates for d5zlpf1.
(The format of our PDB-style files is described here.)

Timeline for d5zlpf1:

  • d5zlpf1 appears in periodic updates to SCOPe 2.07 starting on 2018-08-30