Lineage for d6gzhb2 (6gzh B:151-259)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2326510Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2326511Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2327084Family a.74.1.0: automated matches [227298] (1 protein)
    not a true family
  6. 2327085Protein automated matches [227124] (1 species)
    not a true protein
  7. 2327086Species Human (Homo sapiens) [TaxId:9606] [226765] (9 PDB entries)
  8. 3056917Domain d6gzhb2: 6gzh B:151-259 [356979]
    Other proteins in same PDB: d6gzha_
    automated match to d2pk2a1
    complexed with gol, lci

Details for d6gzhb2

PDB Entry: 6gzh (more details), 3.17 Å

PDB Description: crystal structure of human cdk9/cyclint1 with a86
PDB Compounds: (B:) Cyclin-T1

SCOPe Domain Sequences for d6gzhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gzhb2 a.74.1.0 (B:151-259) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhphthvvkctqlvraskdlaqtsyfmatnslhlttfslqytppvvacvcihlackwsnw
eipvstdgkhwweyvdatvtlelldelthellqilektpnrlkriwnwr

SCOPe Domain Coordinates for d6gzhb2:

Click to download the PDB-style file with coordinates for d6gzhb2.
(The format of our PDB-style files is described here.)

Timeline for d6gzhb2:

  • d6gzhb2 appears in periodic updates to SCOPe 2.07 starting on 2018-08-30

View in 3D
Domains from same chain:
(mouse over for more information)
d6gzhb1
View in 3D
Domains from other chains:
(mouse over for more information)
d6gzha_